General Information

  • ID:  hor003227
  • Uniprot ID:  P05422??48-54)
  • Protein name:  deltorphin A
  • Gene name:  NA
  • Organism:  Phyllomedusa sauvagei (Sauvage's leaf frog)
  • Family:  Frog skin active peptide (FSAP) family, Dermorphin subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Phyllomedusa (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0006952 defense response; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YMFHLMD
  • Length:  7(48-54)
  • Propeptide:  MSFLKKSLLLILFLGLVSLSVCKEEKRETEEENENEENHEEGSEMKRYMFHLMDGEAKKRDSEENEIEENHEEGSEMKRYAFGYPSGEAKKIKRVSEEENENEENHEEGSEMKRYAFGYPSGEAKKIKRESEEEKEIEENHEEGSEMKRYAFGYPSGEAKKIKRESEEENENEENHEEGSEMKRYAFGYPSGEAKKM
  • Signal peptide:  MSFLKKSLLLILFLGLVSLS
  • Modification:  T2 D-methionine;T7 Aspartic acid 1-amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Dermorphin has a very potent opiate-like activity. It has high affinity and selectivity for mu-type opioid receptors.; Deltorphin has a very potent opiate-like activity. It has high affinity and selectivity for delta-type opioid receptors.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P05422-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003227_AF2.pdbhor003227_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 106335 Formula: C44H61N9O11S2
Absent amino acids: ACEGIKNPQRSTVW Common amino acids: M
pI: 5.29 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: 34.29 Boman Index: -92
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 55.71
Instability Index: 7134.29 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  9949868
  • Title:  opioid neuropeptide precursor family Peptides From Frog Skin